Lineage for d1m2oc4 (1m2o C:627-765)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427557Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1427753Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 1427754Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)
  6. 1427755Protein Sec23 [82756] (1 species)
  7. 1427756Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (3 PDB entries)
  8. 1427759Domain d1m2oc4: 1m2o C:627-765 [78489]
    Other proteins in same PDB: d1m2oa1, d1m2oa2, d1m2oa3, d1m2oa5, d1m2ob_, d1m2oc1, d1m2oc2, d1m2oc3, d1m2oc5, d1m2od_
    complexed with gnp, mg, zn

Details for d1m2oc4

PDB Entry: 1m2o (more details), 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex
PDB Compounds: (C:) protein transport protein SEC23

SCOPe Domain Sequences for d1m2oc4:

Sequence, based on SEQRES records: (download)

>d1m2oc4 d.109.2.1 (C:627-765) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl
tddvslqnfmthlqqvavs

Sequence, based on observed residues (ATOM records): (download)

>d1m2oc4 d.109.2.1 (C:627-765) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpstivltddvslqnfmt
hlqqvavs

SCOPe Domain Coordinates for d1m2oc4:

Click to download the PDB-style file with coordinates for d1m2oc4.
(The format of our PDB-style files is described here.)

Timeline for d1m2oc4: