SCOPe 2.06: Domain d1m2oc1: 1m2o C:524-626

Lineage for d1m2oc1 (1m2o C:524-626)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family)
   automatically mapped to Pfam PF04815

5. Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)

6. Protein Sec23 [81813] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81814] (3 PDB entries)

8. Domain d1m2oc1: 1m2o C:524-626 [78486]
   Other proteins in same PDB: d1m2oa2, d1m2oa3, d1m2oa4, d1m2oa5, d1m2ob_, d1m2oc2, d1m2oc3, d1m2oc4, d1m2oc5, d1m2od_
   complexed with gnp, mg, zn

Details for d1m2oc1

PDB Entry: 1m2o, 2.5 Å

PDB Description: Crystal Structure of the Sec23-Sar1 complex

PDB Compounds: (C:) protein transport protein SEC23

SCOPe Domain Sequences for d1m2oc1:

Sequence; same for both SEQRES and ATOM records:

>d1m2oc1 a.71.2.1 (C:524-626) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqeaaavlmariavhkaetddgadvirwldrtliklcqkyadynkddpqsfrlapnfsly
pqftyylrrsqflsvfnnspdetafyrhiftredttnslimiq

Timeline for d1m2oc1:

• d1m2oc1 first appeared in SCOP 1.63
  
• d1m2oc1 appears in SCOPe 2.05
  
• d1m2oc1 appears in SCOPe 2.07
  
• d1m2oc1 appears in the current release, SCOPe 2.08