Lineage for d1m2ea_ (1m2e A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311052Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 311207Family c.23.1.5: N-terminal domain of the circadian clock protein KaiA [82344] (1 protein)
    lacks cannonical receiver domains features
  6. 311208Protein N-terminal domain of the circadian clock protein KaiA [82345] (1 species)
  7. 311209Species Synechococcus elongatus [TaxId:32046] [82346] (2 PDB entries)
  8. 311211Domain d1m2ea_: 1m2e A: [78478]
    CASP5

Details for d1m2ea_

PDB Entry: 1m2e (more details)

PDB Description: solution structure of the n-terminal domain of synechococcus elongatus kaia (kaia135n); average minimized structure.

SCOP Domain Sequences for d1m2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ea_ c.23.1.5 (A:) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus}
mlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
psfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlpyqvda
alaeflrlapvetma

SCOP Domain Coordinates for d1m2ea_:

Click to download the PDB-style file with coordinates for d1m2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ea_: