![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (5 families) ![]() |
![]() | Family c.23.1.5: N-terminal domain of the circadian clock protein KaiA [82344] (1 protein) lacks cannonical receiver domains features |
![]() | Protein N-terminal domain of the circadian clock protein KaiA [82345] (1 species) |
![]() | Species Synechococcus elongatus [TaxId:32046] [82346] (2 PDB entries) |
![]() | Domain d1m2ea_: 1m2e A: [78478] CASP5 |
PDB Entry: 1m2e (more details)
SCOP Domain Sequences for d1m2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2ea_ c.23.1.5 (A:) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus} mlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan psfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlpyqvda alaeflrlapvetma
Timeline for d1m2ea_: