Lineage for d1m1yl_ (1m1y L:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250478Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 250499Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 250520Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  6. 250560Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the interchain arrangment of domains 1 is similar to the intrachain arrangement of domains 2 and 3
  7. 250561Species Azotobacter vinelandii [TaxId:354] [81397] (10 PDB entries)
  8. 250586Domain d1m1yl_: 1m1y L: [78452]
    Other proteins in same PDB: d1m1ya_, d1m1yc_, d1m1ye_, d1m1yf_, d1m1yg_, d1m1yh_, d1m1yi_, d1m1yk_, d1m1ym_, d1m1yn_, d1m1yo_, d1m1yp_
    chemically crosslinked structure
    complexed with ca, cfm, clf, fs4, hca

Details for d1m1yl_

PDB Entry: 1m1y (more details), 3.2 Å

PDB Description: chemical crosslink of nitrogenase mofe protein and fe protein

SCOP Domain Sequences for d1m1yl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1yl_ c.92.2.3 (L:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d1m1yl_:

Click to download the PDB-style file with coordinates for d1m1yl_.
(The format of our PDB-style files is described here.)

Timeline for d1m1yl_: