SCOP 1.67: Domain d1m1tc1: 1m1t C:1-268

Lineage for d1m1tc1 (1m1t C:1-268)

Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (2 families)
Family c.95.1.1: Thiolase-related [53902] (6 proteins)
Protein Biosynthetic thiolase [53905] (1 species)
Species Zoogloea ramigera [TaxId:350] [53906] (11 PDB entries)
Domain d1m1tc1: 1m1t C:1-268 [78437]

Details for d1m1tc1

PDB Entry: 1m1t (more details), 1.94 Å

PDB Description: biosynthetic thiolase, q64a mutant

SCOP Domain Sequences for d1m1tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1tc1 c.95.1.1 (C:1-268) Biosynthetic thiolase {Zoogloea ramigera}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
geganparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

SCOP Domain Coordinates for d1m1tc1:

Click to download the PDB-style file with coordinates for d1m1tc1.
(The format of our PDB-style files is described here.)

Timeline for d1m1tc1: