Lineage for d1m1ac_ (1m1a C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909269Protein Histone H2A [47115] (7 species)
  7. 909270Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries)
  8. 909295Domain d1m1ac_: 1m1a C: [78389]
    Other proteins in same PDB: d1m1aa_, d1m1ab_, d1m1ad_, d1m1ae_, d1m1af_, d1m1ah_
    protein/DNA complex; complexed with imt, mn

Details for d1m1ac_

PDB Entry: 1m1a (more details), 2.65 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna
PDB Compounds: (C:) histone h2a.1

SCOPe Domain Sequences for d1m1ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ac_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d1m1ac_:

Click to download the PDB-style file with coordinates for d1m1ac_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ac_: