Lineage for d1m15a1 (1m15 A:2-95)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496408Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 1496409Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 1496410Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 1496411Protein Arginine kinase, N-domain [48042] (2 species)
  7. 1496421Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (11 PDB entries)
    Uniprot P51541
  8. 1496422Domain d1m15a1: 1m15 A:2-95 [78368]
    Other proteins in same PDB: d1m15a2
    complexed with adp, arg, mg, no3

Details for d1m15a1

PDB Entry: 1m15 (more details), 1.2 Å

PDB Description: transition state structure of arginine kinase
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d1m15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m15a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOPe Domain Coordinates for d1m15a1:

Click to download the PDB-style file with coordinates for d1m15a1.
(The format of our PDB-style files is described here.)

Timeline for d1m15a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m15a2