SCOPe 2.04: Domain d1m0wb1: 1m0w B:1217-1323

Lineage for d1m0wb1 (1m0w B:1217-1323)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein)
   circularly permuted version of prokaryotic enzyme
   automatically mapped to Pfam PF03199

6. Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82378] (2 PDB entries)

8. Domain d1m0wb1: 1m0w B:1217-1323 [78365]
   Other proteins in same PDB: d1m0wa2, d1m0wb2
   complexed with 3gc, anp, mg, so4

Details for d1m0wb1

PDB Entry: 1m0w, 1.8 Å

PDB Description: yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions

PDB Compounds: (B:) glutathione synthetase

SCOPe Domain Sequences for d1m0wb1:

Sequence; same for both SEQRES and ATOM records:

>d1m0wb1 c.30.1.4 (B:1217-1323) Eukaryotic glutathione synthetase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndklfiddktgklfirdte
qeiavvyyrtgytttdytsekdwearlfleksfaikapdlltqlsgs

Timeline for d1m0wb1:

• d1m0wb1 first appeared in SCOP 1.63
  
• d1m0wb1 appears in SCOPe 2.03
  
• d1m0wb1 appears in SCOPe 2.05
  
• d1m0wb1 appears in the current release, SCOPe 2.08