Lineage for d1m0wb1 (1m0w B:1217-1323)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312607Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 312608Superfamily c.30.1: PreATP-grasp domain [52440] (5 families) (S)
    preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 312738Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein)
    circularly permuted version of prokaryotic enzyme
  6. 312739Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species)
  7. 312740Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82378] (2 PDB entries)
  8. 312742Domain d1m0wb1: 1m0w B:1217-1323 [78365]
    Other proteins in same PDB: d1m0wa2, d1m0wb2
    complexed with 3gc, anp, mg, so4

Details for d1m0wb1

PDB Entry: 1m0w (more details), 1.8 Å

PDB Description: yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions

SCOP Domain Sequences for d1m0wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0wb1 c.30.1.4 (B:1217-1323) Eukaryotic glutathione synthetase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae)}
dpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndklfiddktgklfirdte
qeiavvyyrtgytttdytsekdwearlfleksfaikapdlltqlsgs

SCOP Domain Coordinates for d1m0wb1:

Click to download the PDB-style file with coordinates for d1m0wb1.
(The format of our PDB-style files is described here.)

Timeline for d1m0wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m0wb2