SCOP 1.65: Domain d1m0wa2: 1m0w A:6-210,A:324-491

Lineage for d1m0wa2 (1m0w A:6-210,A:324-491)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families)

5. Family d.142.1.6: Eukaryotic glutathione synthetase ATP-binding domain [56088] (1 protein)
   circularly permuted version of prokaryotic enzyme

6. Protein Eukaryotic glutathione synthetase ATP-binding domain [56089] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82788] (2 PDB entries)

8. Domain d1m0wa2: 1m0w A:6-210,A:324-491 [78364]
   Other proteins in same PDB: d1m0wa1, d1m0wb1

Details for d1m0wa2

PDB Entry: 1m0w, 1.8 Å

PDB Description: yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions

SCOP Domain Sequences for d1m0wa2:

Sequence; same for both SEQRES and ATOM records:

>d1m0wa2 d.142.1.6 (A:6-210,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae)}
pskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiq
pvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlg
ifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqn
mvisdsgyllskalakavesyksqqXkkiqqlltdegvlgkyisdaekkssllktfvkiy
plddtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmel
iepelnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsnegg
vaagfgcldsiily

Timeline for d1m0wa2:

• d1m0wa2 first appeared in SCOP 1.63
  
• d1m0wa2 appears in SCOP 1.67
  
• d1m0wa2 appears in the current release, SCOPe 2.08