Lineage for d1m0wa2 (1m0w A:6-210,A:324-491)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.6: Eukaryotic glutathione synthetase ATP-binding domain [56088] (1 protein)
    circularly permuted version of prokaryotic enzyme
    automatically mapped to Pfam PF03917
  6. Protein Eukaryotic glutathione synthetase ATP-binding domain [56089] (2 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82788] (2 PDB entries)
  8. Domain d1m0wa2: 1m0w A:6-210,A:324-491 [78364]
    Other proteins in same PDB: d1m0wa1, d1m0wb1
    complexed with 3gc, anp, mg, so4

Details for d1m0wa2

PDB Entry: 1m0w (more details), 1.8 Å

PDB Description: yeast glutathione synthase bound to gamma-glutamyl-cysteine, amp-pnp and 2 magnesium ions
PDB Compounds: (A:) glutathione synthetase

SCOPe Domain Sequences for d1m0wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m0wa2 d.142.1.6 (A:6-210,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiq
pvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlg
ifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqn
mvisdsgyllskalakavesyksqqXkkiqqlltdegvlgkyisdaekkssllktfvkiy
plddtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayilmel
iepelnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsnegg
vaagfgcldsiily

SCOPe Domain Coordinates for d1m0wa2 are not available.

Timeline for d1m0wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m0wa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1m0wb1, d1m0wb2