SCOP 1.67: Domain d1m0ub1: 1m0u B:123-249

Lineage for d1m0ub1 (1m0u B:123-249)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class sigma GST [81351] (4 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [81771] (1 PDB entry)

8. Domain d1m0ub1: 1m0u B:123-249 [78361]
   Other proteins in same PDB: d1m0ua2, d1m0ub2
   complexed with gtt, so4

Details for d1m0ub1

PDB Entry: 1m0u, 1.75 Å

PDB Description: Crystal Structure of the Drosophila Glutathione S-transferase-2 in Complex with Glutathione

SCOP Domain Sequences for d1m0ub1:

Sequence; same for both SEQRES and ATOM records:

>d1m0ub1 a.45.1.1 (B:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster)}
lcgatpwedlqidivvdtindfrlkiavvsyepedeikekklvtlnaevipfylekleqt
vkdndghlalgkltwadvyfagitdymnymvkrdllepypalrgvvdavnalepikawie
krpvtev

Timeline for d1m0ub1:

• d1m0ub1 first appeared in SCOP 1.63
  
• d1m0ub1 appears in SCOP 1.65
  
• d1m0ub1 appears in SCOP 1.69
  
• d1m0ub1 appears in the current release, SCOPe 2.08