Lineage for d1m0tb2 (1m0t B:1005-1213,B:1324-1491)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671385Family d.142.1.6: Eukaryotic glutathione synthetase ATP-binding domain [56088] (1 protein)
    circularly permuted version of prokaryotic enzyme
    automatically mapped to Pfam PF03917
  6. 1671386Protein Eukaryotic glutathione synthetase ATP-binding domain [56089] (2 species)
  7. 1671387Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82788] (2 PDB entries)
  8. 1671391Domain d1m0tb2: 1m0t B:1005-1213,B:1324-1491 [78358]
    Other proteins in same PDB: d1m0ta1, d1m0tb1
    complexed with so4

Details for d1m0tb2

PDB Entry: 1m0t (more details), 2.3 Å

PDB Description: yeast glutathione synthase
PDB Compounds: (B:) glutathione synthetase

SCOPe Domain Sequences for d1m0tb2:

Sequence, based on SEQRES records: (download)

>d1m0tb2 d.142.1.6 (B:1005-1213,B:1324-1491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
qpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrl
gifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndq
nmvisdsgyllskalakavesyksqqsssXkkiqqlltdegvlgkyisdaekkssllktf
vkiyplddtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayi
lmeliepelnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfnts
neggvaagfgcldsiily

Sequence, based on observed residues (ATOM records): (download)

>d1m0tb2 d.142.1.6 (B:1005-1213,B:1324-1491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
qpvfnelyaritqdmaqpdsyleftgklwslylatlksaqykkqnfrlgifrsdylidkk
eqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqnmvisdsgyllskal
akavesyksqqsssXkkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgreg
krlalsepskyvlkpqnnvykenipnflkgieerhwdayilmeliepelnenniilrdnk
synepiiselgiygcvlfndeqvlsnefsgsllrskfgcldsiily

SCOPe Domain Coordinates for d1m0tb2:

Click to download the PDB-style file with coordinates for d1m0tb2.
(The format of our PDB-style files is described here.)

Timeline for d1m0tb2:

Domains from same chain:
(mouse over for more information)
d1m0tb1
Domains from other chains:
(mouse over for more information)
d1m0ta1, d1m0ta2