SCOPe 2.08: Domain d1m0tb1: 1m0t B:1214-1323

Lineage for d1m0tb1 (1m0t B:1214-1323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.4: Eukaryotic glutathione synthetase, substrate-binding domain [52460] (1 protein)
   circularly permuted version of prokaryotic enzyme
   automatically mapped to Pfam PF03199

6. Protein Eukaryotic glutathione synthetase, substrate-binding domain [52461] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82378] (2 PDB entries)

8. Domain d1m0tb1: 1m0t B:1214-1323 [78357]
   Other proteins in same PDB: d1m0ta2, d1m0tb2
   complexed with so4

Details for d1m0tb1

PDB Entry: 1m0t, 2.3 Å

PDB Description: yeast glutathione synthase

PDB Compounds: (B:) glutathione synthetase

SCOPe Domain Sequences for d1m0tb1:

Sequence; same for both SEQRES and ATOM records:

>d1m0tb1 c.30.1.4 (B:1214-1323) Eukaryotic glutathione synthetase, substrate-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttsdpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndklfiddktgklfir
dteqeiavvyyrtgytttdytsekdwearlfleksfaikapdlltqlsgs

Timeline for d1m0tb1:

• d1m0tb1 first appeared in SCOP 1.63
  
• d1m0tb1 appears in SCOPe 2.07