Lineage for d1m0ta2 (1m0t A:5-213,A:324-491)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418907Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 418908Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 419092Family d.142.1.6: Eukaryotic glutathione synthetase ATP-binding domain [56088] (1 protein)
    circularly permuted version of prokaryotic enzyme
  6. 419093Protein Eukaryotic glutathione synthetase ATP-binding domain [56089] (2 species)
  7. 419094Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82788] (2 PDB entries)
  8. 419097Domain d1m0ta2: 1m0t A:5-213,A:324-491 [78356]
    Other proteins in same PDB: d1m0ta1, d1m0tb1

Details for d1m0ta2

PDB Entry: 1m0t (more details), 2.3 Å

PDB Description: yeast glutathione synthase

SCOP Domain Sequences for d1m0ta2:

Sequence, based on SEQRES records: (download)

>d1m0ta2 d.142.1.6 (A:5-213,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae)}
ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
qpvfnelyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrl
gifrsdylidkkkgteqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndq
nmvisdsgyllskalakavesyksqqsssXkkiqqlltdegvlgkyisdaekkssllktf
vkiyplddtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayi
lmeliepelnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfnts
neggvaagfgcldsiily

Sequence, based on observed residues (ATOM records): (download)

>d1m0ta2 d.142.1.6 (A:5-213,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae)}
ppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqi
qpvfnelyaritqdmaqpdsylftgklwslylatlksaqykkqnfrlgifrsdylidkke
qikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqnmvisdsgyllskala
kavesyksqqsssXkkiqqlltdegvlgkyisdaekkssllktfvkiyplddtklgregk
rlalsepskyvlkpqgnnvykenipnflkgieerhwdayilmeliepelnenniilrdnk
synepiiselgiygcvlfndeqvlsnefsgsllrskgcldsiily

SCOP Domain Coordinates for d1m0ta2:

Click to download the PDB-style file with coordinates for d1m0ta2.
(The format of our PDB-style files is described here.)

Timeline for d1m0ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m0ta1