Lineage for d1lzwa_ (1lzw A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503224Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 503225Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 503240Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 503241Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 503242Species Escherichia coli [TaxId:562] [82643] (5 PDB entries)
  8. 503248Domain d1lzwa_: 1lzw A: [78312]
    Other proteins in same PDB: d1lzwb_
    complex with ClpA N-domain

Details for d1lzwa_

PDB Entry: 1lzw (more details), 2.5 Å

PDB Description: structural basis of clps-mediated switch in clpa substrate recognition

SCOP Domain Sequences for d1lzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lzwa_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli}
ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
ftaevaetkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1lzwa_:

Click to download the PDB-style file with coordinates for d1lzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1lzwa_: