Lineage for d1lxma1 (1lxm A:249-619)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284360Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incoplete toroid
  5. 284366Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 284377Protein Hyaluronate lyase [48237] (2 species)
  7. 284378Species Streptococcus agalactiae [TaxId:1311] [69089] (3 PDB entries)
    preceeded by a small all-beta Ig-like domain
  8. 284381Domain d1lxma1: 1lxm A:249-619 [78296]
    Other proteins in same PDB: d1lxma2, d1lxma3, d1lxma4
    complexed with gcu, nag

Details for d1lxma1

PDB Entry: 1lxm (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with hexasaccharide unit of hyaluronan

SCOP Domain Sequences for d1lxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxma1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae}
ednftklldkwndvtignyvydtndsnmqklnqkldetnaknieaikldsnrtflwkdld
nlnnsaqltatyrrledlakqitnphstiyknekairtvkeslawlhqnfynvnkdiegs
anwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpdaeyfrktlvnpfkalgg
nlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfyadgsyidhtnvaytgay
gnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivkgelmdmsrgrsisrea
asshaaavevlrgflrlanmsneernldlkstiktiitsnkfynvfnnlksysdianmnk
llndstvatkp

SCOP Domain Coordinates for d1lxma1:

Click to download the PDB-style file with coordinates for d1lxma1.
(The format of our PDB-style files is described here.)

Timeline for d1lxma1: