SCOP 1.63: Domain d1lwea1: 1lwe A:430-554

Lineage for d1lwea1 (1lwe A:430-554)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)

8. Domain d1lwea1: 1lwe A:430-554 [78267]
   Other proteins in same PDB: d1lwea2, d1lweb_
   complexed with csd, nvp, po4; mutant

Details for d1lwea1

PDB Entry: 1lwe, 2.81 Å

PDB Description: crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine

SCOP Domain Sequences for d1lwea1:

Sequence; same for both SEQRES and ATOM records:

>d1lwea1 c.55.3.1 (A:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d1lwea1:

• d1lwea1 is new in SCOP 1.63
  
• d1lwea1 appears in SCOP 1.65
  
• d1lwea1 appears in the current release, SCOPe 2.08