Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein Low-specificity threonine aldolase [64123] (2 species) |
Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries) |
Domain d1lw4c_: 1lw4 C: [78256] Other proteins in same PDB: d1lw4d2 complexed with ca, cl, plp, tlp |
PDB Entry: 1lw4 (more details), 1.9 Å
SCOPe Domain Sequences for d1lw4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw4c_ c.67.1.1 (C:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
Timeline for d1lw4c_:
View in 3D Domains from other chains: (mouse over for more information) d1lw4a_, d1lw4b_, d1lw4d1, d1lw4d2 |