![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species) |
![]() | Species Tobacco etch virus, TEV [TaxId:12227] [82127] (2 PDB entries) |
![]() | Domain d1lvm.1: 1lvm A:,E: [78243] |
PDB Entry: 1lvm (more details), 1.8 Å
SCOP Domain Sequences for d1lvm.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1lvm.1 b.47.1.3 (A:,E:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV} ghhhhhhhgeslfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnn gtllvqslhgvfkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlv ttnfqtksmssmvsdtsctfpssdgifwkhwiqtkdgqcgsplvstrdgfivgihsasnf tntnnyftsvpknfmelltnqeaqqwvsgwrlnadsvlwgghkvfmdkpXeatqlmn
Timeline for d1lvm.1: