Lineage for d1lufa_ (1luf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435230Protein Musk tyrosine kinase [82797] (1 species)
    PTK group; MUSK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1435231Species Norway rat (Rattus norvegicus) [TaxId:10116] [82798] (1 PDB entry)
  8. 1435232Domain d1lufa_: 1luf A: [78223]

Details for d1lufa_

PDB Entry: 1luf (more details), 2.05 Å

PDB Description: crystal structure of the musk tyrosine kinase: insights into receptor autoregulation
PDB Compounds: (A:) muscle-specific tyrosine kinase receptor musk

SCOPe Domain Sequences for d1lufa_:

Sequence, based on SEQRES records: (download)

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lnpkllsleyprnnieyvrdigegafgrvfqarapgllpyepftmvavkmlkeeasadmq
adfqreaalmaefdnpnivkllgvcavgkpmcllfeymaygdlneflrsmsphtvcslsh
sdlstrarvsspgppplscaeqlciarqvaagmaylserkfvhrdlatrnclvgenmvvk
iadfglsrniysadyykadgndaipirwmppesifynryttesdvwaygvvlweifsygl
qpyygmaheeviyyvrdgnilacpencplelynlmrlcwsklpadrpsfcsihrilqrmc
e

Sequence, based on observed residues (ATOM records): (download)

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lnpkllsleyprnnieyvrdigegafgrvfqarapgllpyepftmvavkmlkeeasadmq
adfqreaalmaefdnpnivkllgvcavgkpmcllfeymaygdlneflrsmsppplscaeq
lciarqvaagmaylserkfvhrdlatrnclvgenmvvkiadfglsrniysadyykdaipi
rwmppesifynryttesdvwaygvvlweifsyglqpyygmaheeviyyvrdgnilacpen
cplelynlmrlcwsklpadrpsfcsihrilqrmce

SCOPe Domain Coordinates for d1lufa_:

Click to download the PDB-style file with coordinates for d1lufa_.
(The format of our PDB-style files is described here.)

Timeline for d1lufa_: