Lineage for d1ltjd_ (1ltj D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2590756Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2590757Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2590758Protein Fibrinogen alpha chain [88887] (4 species)
  7. 2590767Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 2590782Domain d1ltjd_: 1ltj D: [78203]
    Other proteins in same PDB: d1ltjb1, d1ltjb2, d1ltjc1, d1ltjc2, d1ltje1, d1ltje2, d1ltjf1, d1ltjf2
    coiled-coil region only
    complexed with ca

Details for d1ltjd_

PDB Entry: 1ltj (more details), 2.8 Å

PDB Description: Crystal Structure of Recombinant Human Fibrinogen Fragment D with the Peptide Ligands Gly-Pro-Arg-Pro-Amide and Gly-His-Arg-Pro-Amide
PDB Compounds: (D:) Fibrinogen alpha/alpha-E Chain

SCOPe Domain Sequences for d1ltjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltjd_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvia

SCOPe Domain Coordinates for d1ltjd_:

Click to download the PDB-style file with coordinates for d1ltjd_.
(The format of our PDB-style files is described here.)

Timeline for d1ltjd_: