SCOP 1.75: Domain d1ltjc2: 1ltj C:96-141

Lineage for d1ltjc2 (1ltj C:96-141)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1ltjc2: 1ltj C:96-141 [78202]
   Other proteins in same PDB: d1ltja_, d1ltjb1, d1ltjb2, d1ltjc1, d1ltjd_, d1ltje1, d1ltje2, d1ltjf1
   coiled-coil region only

Details for d1ltjc2

PDB Entry: 1ltj, 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide

PDB Compounds: (C:) Fibrinogen gamma chain

SCOP Domain Sequences for d1ltjc2:

Sequence; same for both SEQRES and ATOM records:

>d1ltjc2 h.1.8.1 (C:96-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1ltjc2:

• d1ltjc2 first appeared in SCOP 1.63
  
• d1ltjc2 appears in SCOP 1.73
  
• d1ltjc2 appears in SCOPe 2.01
  
• d1ltjc2 appears in the current release, SCOPe 2.08