![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.110: Profilin-like [55769] (5 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (5 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.2: Histidine kinase FixL heme domain [55789] (1 protein) |
![]() | Protein Histidine kinase FixL heme domain [55790] (2 species) |
![]() | Species Bradyrhizobium japonicum [TaxId:375] [55792] (8 PDB entries) |
![]() | Domain d1lsxa_: 1lsx A: [78182] complexed with 1mz, hem |
PDB Entry: 1lsx (more details), 2.7 Å
SCOP Domain Sequences for d1lsxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsxa_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum} damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel
Timeline for d1lsxa_: