Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.110: Profilin-like [55769] (5 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (5 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.2: Histidine kinase FixL heme domain [55789] (1 protein) |
Protein Histidine kinase FixL heme domain [55790] (2 species) |
Species Bradyrhizobium japonicum [TaxId:375] [55792] (8 PDB entries) |
Domain d1lsva_: 1lsv A: [78180] complexed with cmo, hem |
PDB Entry: 1lsv (more details), 2.4 Å
SCOP Domain Sequences for d1lsva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lsva_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum} damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq
Timeline for d1lsva_: