Lineage for d1ls9a_ (1ls9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304440Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species)
  7. 2304465Species Green alga (Cladophora glomerata) [TaxId:162068] [81674] (1 PDB entry)
  8. 2304466Domain d1ls9a_: 1ls9 A: [78177]
    complexed with hem

Details for d1ls9a_

PDB Entry: 1ls9 (more details), 1.3 Å

PDB Description: Structure of the Cytochrome c6 from the Green Alga Cladophora glomerata
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1ls9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls9a_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Cladophora glomerata) [TaxId: 162068]}
vdaelladgkkvfagncaachlggnnsvladktlkkdaiekyleggltleaikyqvnngk
gampawadrldeddieavsnyvydqavnskw

SCOPe Domain Coordinates for d1ls9a_:

Click to download the PDB-style file with coordinates for d1ls9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ls9a_: