SCOPe 2.03: Domain d1lqmd_: 1lqm D:

Lineage for d1lqmd_ (1lqm D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries)

8. Domain d1lqmd_: 1lqm D: [78144]
   Other proteins in same PDB: d1lqma_, d1lqmc_, d1lqme_, d1lqmg_
   protein/DNA complex

Details for d1lqmd_

PDB Entry: 1lqm, 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

PDB Compounds: (D:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d1lqmd_:

Sequence; same for both SEQRES and ATOM records:

>d1lqmd_ d.17.5.1 (D:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

Timeline for d1lqmd_:

• d1lqmd_ first appeared in SCOP 1.63
  
• d1lqmd_ appears in SCOPe 2.02
  
• d1lqmd_ appears in SCOPe 2.04
  
• d1lqmd_ appears in the current release, SCOPe 2.08