SCOPe 2.08: Domain d1lqjc1: 1lqj C:2-229

Lineage for d1lqjc1 (1lqj C:2-229)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqjc1: 1lqj C:2-229 [78137]
   Other proteins in same PDB: d1lqja2, d1lqjb2, d1lqjc2

Details for d1lqjc1

PDB Entry: 1lqj, 3.35 Å

PDB Description: escherichia coli uracil-dna glycosylase

PDB Compounds: (C:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1lqjc1:

Sequence; same for both SEQRES and ATOM records:

>d1lqjc1 c.18.1.1 (C:2-229) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese

Timeline for d1lqjc1:

• d1lqjc1 first appeared in SCOP 1.63, called d1lqjc_
  
• d1lqjc1 appears in SCOPe 2.07