Lineage for d1loka_ (1lok A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 997614Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 997791Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 997802Protein Aminopeptidase [53205] (2 species)
  7. 997803Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries)
    Uniprot Q01693
    synonym: Vibrio proteolyticus
  8. 997807Domain d1loka_: 1lok A: [78122]
    complexed with na, scn, trs, zn

Details for d1loka_

PDB Entry: 1lok (more details), 1.2 Å

PDB Description: the 1.20 angstrom resolution crystal structure of the aminopeptidase from aeromonas proteolytica complexed with tris: a tale of buffer inhibition
PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOPe Domain Sequences for d1loka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loka_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOPe Domain Coordinates for d1loka_:

Click to download the PDB-style file with coordinates for d1loka_.
(The format of our PDB-style files is described here.)

Timeline for d1loka_: