Lineage for d1lo5d2 (1lo5 D:121-233)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325765Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 325766Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)
  8. 325775Domain d1lo5d2: 1lo5 D:121-233 [78121]
    Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5b2, d1lo5d1
    mutant

Details for d1lo5d2

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

SCOP Domain Sequences for d1lo5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5d2 d.15.6.1 (D:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhiaiylyts

SCOP Domain Coordinates for d1lo5d2:

Click to download the PDB-style file with coordinates for d1lo5d2.
(The format of our PDB-style files is described here.)

Timeline for d1lo5d2: