Lineage for d1lo5b1 (1lo5 B:93-190)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453132Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 453140Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (29 PDB entries)
    probably orthologous to the mouse I-E group
  8. 453179Domain d1lo5b1: 1lo5 B:93-190 [78118]
    Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b2, d1lo5d1, d1lo5d2

Details for d1lo5b1

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

SCOP Domain Sequences for d1lo5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5b1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1lo5b1:

Click to download the PDB-style file with coordinates for d1lo5b1.
(The format of our PDB-style files is described here.)

Timeline for d1lo5b1: