![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
![]() | Domain d1lo5a2: 1lo5 A:4-81 [78117] Other proteins in same PDB: d1lo5a1, d1lo5b1, d1lo5b2, d1lo5d1, d1lo5d2 complexed with a peptide from hemagglutinin |
PDB Entry: 1lo5 (more details), 3.2 Å
SCOPe Domain Sequences for d1lo5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo5a2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1lo5a2:
![]() Domains from other chains: (mouse over for more information) d1lo5b1, d1lo5b2, d1lo5d1, d1lo5d2 |