Lineage for d1lo5a2 (1lo5 A:4-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198446Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
    Uniprot P01903 28-207
  8. 1198468Domain d1lo5a2: 1lo5 A:4-81 [78117]
    Other proteins in same PDB: d1lo5a1, d1lo5b1, d1lo5b2, d1lo5d1, d1lo5d2
    complexed with a peptide from hemagglutinin

Details for d1lo5a2

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1lo5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5a2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1lo5a2:

Click to download the PDB-style file with coordinates for d1lo5a2.
(The format of our PDB-style files is described here.)

Timeline for d1lo5a2: