Lineage for d1lo5a1 (1lo5 A:82-182)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107077Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1107085Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 1107124Domain d1lo5a1: 1lo5 A:82-182 [78116]
    Other proteins in same PDB: d1lo5a2, d1lo5b1, d1lo5b2, d1lo5d1, d1lo5d2

Details for d1lo5a1

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1lo5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5a1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOPe Domain Coordinates for d1lo5a1:

Click to download the PDB-style file with coordinates for d1lo5a1.
(The format of our PDB-style files is described here.)

Timeline for d1lo5a1: