SCOP 1.75: Domain d1lnza2: 1lnz A:158-342

Lineage for d1lnza2 (1lnz A:158-342)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Obg GTP-binding protein middle domain [82408] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [82409] (1 PDB entry)

8. Domain d1lnza2: 1lnz A:158-342 [78113]
   Other proteins in same PDB: d1lnza1, d1lnzb1

Details for d1lnza2

PDB Entry: 1lnz, 2.6 Å

PDB Description: structure of the obg gtp-binding protein

PDB Compounds: (A:) SPO0B-associated GTP-binding protein

SCOP Domain Sequences for d1lnza2:

Sequence; same for both SEQRES and ATOM records:

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}
ladvglvgfpsvgkstllsvvssakpkiadyhfttlvpnlgmvetddgrsfvmadlpgli
egahqgvglghqflrhiertrvivhvidmsglegrdpyddyltinqelseynlrlterpq
iivankmdmpeaaenleafkekltddypvfpisavtreglrellfevanqlentpefply
deeel

Timeline for d1lnza2:

• d1lnza2 first appeared in SCOP 1.63
  
• d1lnza2 appears in SCOP 1.73
  
• d1lnza2 appears in SCOPe 2.01
  
• d1lnza2 appears in the current release, SCOPe 2.08