Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins) |
Protein AMPC beta-Lactamase, class C [56618] (3 species) contains small alpha+beta subdomain inserted in the common fold |
Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (39 PDB entries) |
Domain d1llbb_: 1llb B: [78093] complexed with pcn |
PDB Entry: 1llb (more details), 1.72 Å
SCOP Domain Sequences for d1llbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llbb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
Timeline for d1llbb_: