Lineage for d1ll4b2 (1ll4 B:293-354)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255830Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 255831Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins)
  6. 255832Protein Chitinase 1 [54562] (1 species)
  7. 255833Species Fungus (Coccidioides immitis) [TaxId:5501] [54563] (4 PDB entries)
  8. 255842Domain d1ll4b2: 1ll4 B:293-354 [78070]
    Other proteins in same PDB: d1ll4a1, d1ll4b1, d1ll4c1, d1ll4d1

Details for d1ll4b2

PDB Entry: 1ll4 (more details), 2.8 Å

PDB Description: structure of c. immitis chitinase 1 complexed with allosamidin
PDB Compounds: (B:)

SCOP Domain Sequences for d1ll4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll4b2 d.26.3.1 (B:293-354) Chitinase 1 {Fungus (Coccidioides immitis)}
ygrafastdgigtsfngvgggswengvwdykdmpqqgaqvtelediaasysydknkryli
sy

SCOP Domain Coordinates for d1ll4b2:

Click to download the PDB-style file with coordinates for d1ll4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ll4b2: