Lineage for d1ll4b1 (1ll4 B:36-292,B:355-427)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236839Family c.1.8.5: Type II chitinase [51534] (11 proteins)
    glycosylase family 18
  6. 236840Protein Chitinase 1 [51548] (1 species)
  7. 236841Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (4 PDB entries)
  8. 236850Domain d1ll4b1: 1ll4 B:36-292,B:355-427 [78069]
    Other proteins in same PDB: d1ll4a2, d1ll4b2, d1ll4c2, d1ll4d2

Details for d1ll4b1

PDB Entry: 1ll4 (more details), 2.8 Å

PDB Description: structure of c. immitis chitinase 1 complexed with allosamidin
PDB Compounds: (B:)

SCOP Domain Sequences for d1ll4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll4b1 c.1.8.5 (B:36-292,B:355-427) Chitinase 1 {Fungus (Coccidioides immitis)}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

SCOP Domain Coordinates for d1ll4b1:

Click to download the PDB-style file with coordinates for d1ll4b1.
(The format of our PDB-style files is described here.)

Timeline for d1ll4b1: