Lineage for d1lkpa2 (1lkp A:148-191)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966025Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1966026Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1966128Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 1966129Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries)
    Uniprot P24931
  8. 1966130Domain d1lkpa2: 1lkp A:148-191 [78066]
    Other proteins in same PDB: d1lkpa1
    complexed with azi, fe2

Details for d1lkpa2

PDB Entry: 1lkp (more details), 1.64 Å

PDB Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(II) form, azide adduct
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1lkpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkpa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

SCOPe Domain Coordinates for d1lkpa2:

Click to download the PDB-style file with coordinates for d1lkpa2.
(The format of our PDB-style files is described here.)

Timeline for d1lkpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lkpa1