Lineage for d1lkpa1 (1lkp A:2-147)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766631Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 766637Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
    Uniprot P24931
  8. 766639Domain d1lkpa1: 1lkp A:2-147 [78065]
    Other proteins in same PDB: d1lkpa2
    complexed with azi, fe2

Details for d1lkpa1

PDB Entry: 1lkp (more details), 1.64 Å

PDB Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(II) form, azide adduct
PDB Compounds: (A:) rubrerythrin

SCOP Domain Sequences for d1lkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkpa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

SCOP Domain Coordinates for d1lkpa1:

Click to download the PDB-style file with coordinates for d1lkpa1.
(The format of our PDB-style files is described here.)

Timeline for d1lkpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lkpa2