![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (10 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (3 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (2 proteins) |
![]() | Protein Rubrerythrin, C-terminal domain [57811] (1 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [57812] (7 PDB entries) |
![]() | Domain d1lkoa2: 1lko A:148-191 [78064] Other proteins in same PDB: d1lkoa1 complexed with fe2 |
PDB Entry: 1lko (more details), 1.63 Å
SCOP Domain Sequences for d1lkoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris} flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw
Timeline for d1lkoa2: