SCOP 1.63: Domain d1lkoa1: 1lko A:2-147

Lineage for d1lkoa1 (1lko A:2-147)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)
   contains dimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (7 PDB entries)

8. Domain d1lkoa1: 1lko A:2-147 [78063]
   Other proteins in same PDB: d1lkoa2
   complexed with fe2

Details for d1lkoa1

PDB Entry: 1lko, 1.63 Å

PDB Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(II) form

SCOP Domain Sequences for d1lkoa1:

Sequence; same for both SEQRES and ATOM records:

>d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

Timeline for d1lkoa1:

• d1lkoa1 is new in SCOP 1.63
  
• d1lkoa1 appears in SCOP 1.65
  
• d1lkoa1 appears in the current release, SCOPe 2.08