Lineage for d1lkma2 (1lkm A:148-191)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587652Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2587758Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 2587759Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries)
    Uniprot P24931
  8. 2587762Domain d1lkma2: 1lkm A:148-191 [78062]
    Other proteins in same PDB: d1lkma1
    complexed with fe

Details for d1lkma2

PDB Entry: 1lkm (more details), 1.69 Å

PDB Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(III) form
PDB Compounds: (A:) Rubrerythrin all-iron(III) form

SCOPe Domain Sequences for d1lkma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkma2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

SCOPe Domain Coordinates for d1lkma2:

Click to download the PDB-style file with coordinates for d1lkma2.
(The format of our PDB-style files is described here.)

Timeline for d1lkma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lkma1