Class a: All alpha proteins [46456] (179 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (2 families) contains dimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (5 proteins) |
Protein Rubrerythrin, N-terminal domain [47242] (1 species) |
Species Desulfovibrio vulgaris [TaxId:881] [47243] (7 PDB entries) |
Domain d1lkma1: 1lkm A:2-147 [78061] Other proteins in same PDB: d1lkma2 complexed with fe |
PDB Entry: 1lkm (more details), 1.69 Å
SCOP Domain Sequences for d1lkma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkma1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris} kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf asiavaeefhekrfldfarnikegrv
Timeline for d1lkma1: