Lineage for d1lkma1 (1lkm A:2-147)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279906Protein Rubrerythrin, N-terminal domain [47242] (1 species)
  7. 279907Species Desulfovibrio vulgaris [TaxId:881] [47243] (7 PDB entries)
  8. 279910Domain d1lkma1: 1lkm A:2-147 [78061]
    Other proteins in same PDB: d1lkma2
    complexed with fe

Details for d1lkma1

PDB Entry: 1lkm (more details), 1.69 Å

PDB Description: Crystal structure of Desulfovibrio vulgaris rubrerythrin all-iron(III) form

SCOP Domain Sequences for d1lkma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkma1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

SCOP Domain Coordinates for d1lkma1:

Click to download the PDB-style file with coordinates for d1lkma1.
(The format of our PDB-style files is described here.)

Timeline for d1lkma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lkma2