SCOPe 2.07: Domain d1ljma_: 1ljm A:

Lineage for d1ljma_ (1ljm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)

8. Domain d1ljma_: 1ljm A: [78051]
   complexed with cl

Details for d1ljma_

PDB Entry: 1ljm, 2.5 Å

PDB Description: DNA recognition is mediated by conformational transition and by DNA bending

PDB Compounds: (A:) RUNX1 transcription factor

SCOPe Domain Sequences for d1ljma_:

Sequence; same for both SEQRES and ATOM records:

>d1ljma_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
elvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrna
taamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpr

Timeline for d1ljma_:

• d1ljma_ first appeared in SCOP 1.63
  
• d1ljma_ appears in SCOPe 2.06
  
• d1ljma_ appears in the current release, SCOPe 2.08