Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (11 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries) Uniprot P00695 |
Domain d1ljkb_: 1ljk B: [78050] complexed with no3 |
PDB Entry: 1ljk (more details), 2.1 Å
SCOP Domain Sequences for d1ljkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljkb_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1ljkb_: