Lineage for d1lj8a1 (1lj8 A:193-492)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216282Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 216283Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 216353Family a.100.1.9: Mannitol 2-dehydrogenase [81843] (1 protein)
  6. 216354Protein Mannitol 2-dehydrogenase [81844] (1 species)
    duplication; contains two structural repeats
  7. 216355Species Pseudomonas fluorescens [TaxId:294] [81845] (2 PDB entries)
  8. 216356Domain d1lj8a1: 1lj8 A:193-492 [78033]
    Other proteins in same PDB: d1lj8a2
    complexed with mse, nad

Details for d1lj8a1

PDB Entry: 1lj8 (more details), 1.7 Å

PDB Description: Crystal structure of mannitol dehydrogenase in complex with NAD

SCOP Domain Sequences for d1lj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj8a1 a.100.1.9 (A:193-492) Mannitol 2-dehydrogenase {Pseudomonas fluorescens}
phngavtrkallafaalhnaelhdwikahvsfpnamvdritpmtstahrlqlhdehgidd
awpvvcepfvqwvledkfvngrpawekvgvqftddvtpyeemkigllngshlaltylgfl
kgyrfvhetmndplfvaymraymdldvtpnlapvpgidltdykqtlvdrfsnqaiadqle
rvcsdgsskfpkftvptinrliadgreteraalvvaawalylkgvdengvsytipdprae
fcqglvsddalisqrllaveeifgtaipnspefvaafercygslrdngvtttlkhllkkp

SCOP Domain Coordinates for d1lj8a1:

Click to download the PDB-style file with coordinates for d1lj8a1.
(The format of our PDB-style files is described here.)

Timeline for d1lj8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lj8a2