Lineage for d1liza_ (1liz A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 298004Superfamily b.40.9: Heme chaperone CcmE [82093] (1 family) (S)
  5. 298005Family b.40.9.1: Heme chaperone CcmE [82094] (1 protein)
  6. 298006Protein Heme chaperone CcmE [82095] (2 species)
  7. 298007Species Escherichia coli [TaxId:562] [82096] (1 PDB entry)
  8. 298008Domain d1liza_: 1liz A: [78018]

Details for d1liza_

PDB Entry: 1liz (more details)

PDB Description: Solution structure of the heme chaperone CcmE of Escherichia coli

SCOP Domain Sequences for d1liza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liza_ b.40.9.1 (A:) Heme chaperone CcmE {Escherichia coli}
lrsnidlfytpgeilygkretqqmpevgqrlrvggmvmpgsvqrdpnslkvtftiydaeg
svdvsyegilpdlfregqgvvvqgelekgnhilakevlakhdenytppevekam

SCOP Domain Coordinates for d1liza_:

Click to download the PDB-style file with coordinates for d1liza_.
(The format of our PDB-style files is described here.)

Timeline for d1liza_: