Lineage for d1liyc2 (1liy C:58-159,C:262-439)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818190Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (7 families) (S)
  5. 818191Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 818192Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 818213Species Human (Homo sapiens) [TaxId:9606] [82273] (4 PDB entries)
  8. 818224Domain d1liyc2: 1liy C:58-159,C:262-439 [78013]
    Other proteins in same PDB: d1liya1, d1liya3, d1liyb1, d1liyb3, d1liyc1, d1liyc3, d1liyd1, d1liyd3

Details for d1liyc2

PDB Entry: 1liy (more details), 2.74 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg479His mutant
PDB Compounds: (C:) Pyruvate kinase, isozymes R/L

SCOP Domain Sequences for d1liyc2:

Sequence, based on SEQRES records: (download)

>d1liyc2 c.1.12.1 (C:58-159,C:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniarl
nfshgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgveh
gvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvarg
dlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldg
adcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

Sequence, based on observed residues (ATOM records): (download)

>d1liyc2 c.1.12.1 (C:58-159,C:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qqqlpaadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniarlnf
shgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgvehgv
divfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdl
gieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgad
cimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

SCOP Domain Coordinates for d1liyc2:

Click to download the PDB-style file with coordinates for d1liyc2.
(The format of our PDB-style files is described here.)

Timeline for d1liyc2: